DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc5

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001034427.1 Gene:Zdhhc5 / 362156 RGDID:1589737 Length:715 Species:Rattus norvegicus


Alignment Length:401 Identity:93/401 - (23%)
Similarity:138/401 - (34%) Gaps:150/401 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YHLFLTLFMWSYWRTIMTSVGRIPDQWRIP----DEEVSRLFRADSPDTQKRILNNFARDLPVTN 121
            |:..:.||:.:.:     |:....|....|    ||:....|||....|             |..
  Rat    50 YNAIMFLFVLANF-----SMATFMDPGIFPRAEEDEDKEDDFRAPLYKT-------------VEI 96

  Fly   122 RTMNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFL-------- 178
            :.:...:::|..|:..:|.|..|||||..||.:.||||||||||:...||:||.|||        
  Rat    97 KGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIM 161

  Fly   179 ---GYALVYCLYVAFTSLHDFVEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISL 240
               |:.|:|.|      .|  :|                  ..||:.....:.:..:|.:|.|.:
  Rat   162 GVFGFGLLYVL------CH--IE------------------ELSGVRTAVTMAVMCVAGLFFIPV 200

  Fly   241 VSLFGYHIYLVLVNRTTLESFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFLPVFSSRGD 305
            ..|.|:|:.||...|||.|       :|.|..:.|.|  .:.|.|                    
  Rat   201 AGLTGFHVVLVARGRTTNE-------QVTGKFRGGVN--PFTNGC-------------------- 236

  Fly   306 GYSYPTSSDQSRVSTSSPTQRYDAMGDTTTSRLDGNPTDKLIGASPLDTTNHHHNQSPHQVRSTS 370
                  .::.|||..|||..||                   :|....:.|               
  Rat   237 ------CNNVSRVLCSSPAPRY-------------------LGRPKKEKT--------------- 261

  Fly   371 VLPTQLLQIQPPSTCRDELNERQQKLANGQSLDCSTPAAMSSPDERGVNGAAVYIEMIGDHPLTS 435
                  :.|:|| ..|.|:::.|           .|...|    :.|:.|.....:..|...:|.
  Rat   262 ------IVIRPP-FLRPEVSDGQ-----------ITVKIM----DNGIQGELRRTKSKGSLEITE 304

  Fly   436 ADPAKGFPRPP 446
            :..|...|.||
  Rat   305 SQSADAEPPPP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 47/140 (34%)
Zdhhc5NP_001034427.1 zf-DHHC 99..224 CDD:279823 49/157 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.