DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc6

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001032741.1 Gene:Zdhhc6 / 361771 RGDID:1304657 Length:413 Species:Rattus norvegicus


Alignment Length:331 Identity:79/331 - (23%)
Similarity:136/331 - (41%) Gaps:104/331 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WIPVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFY---HL------FLTLFMW------S 71
            |.|::.:.          |:.:|     :.:.||..:|:|   |.      |:.|..|      :
  Rat    22 WGPIIALG----------VIAIC-----STMAMIDSVLWYWPLHTTGGSVNFIMLINWTVMILYN 71

  Fly    72 YWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKI 136
            |:..:....|.:|..|: |:.....::                             :::|:.|:.
  Rat    72 YFNAMFAGPGFVPRGWK-PENPQDSMY-----------------------------LQYCKVCQA 106

  Fly   137 IKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAF-------TSLH 194
            .|..|:|||..|:.||:||||||||:|||....|:..|.|||..|.:.|.:.||       |.|:
  Rat   107 YKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHQNHASFTLFLLLAPLGCTHAAFIFVMTMYTQLY 171

  Fly   195 DFVEF-WKVGAYDNNGYSAQGQLNAS----------GMGRF-HILFLFFIAIMFAISLVSLFGYH 247
            :.:.| |.....|         ::|:          |:..| ..||...:|:...|::..||...
  Rat   172 NRLSFGWNTVKID---------MSAARRDPPPIVPFGLAAFAATLFALGLALGTTIAVGMLFFIQ 227

  Fly   248 IYLVLVNRTTLESF-------RAPIFRVGGPDKNGYNLG-RYANFCEVFGDDWQYWFLPVFSSRG 304
            |.::|.|:|::||:       |...:::.......|::| ::.|..:||  .|.  .:|    .|
  Rat   228 IKIILRNKTSIESWIEEKAKDRIQYYQLDEVFVFPYDMGSKWKNLKQVF--TWS--GVP----EG 284

  Fly   305 DGYSYP 310
            ||..:|
  Rat   285 DGLEWP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 48/148 (32%)
Zdhhc6NP_001032741.1 DHHC 95..241 CDD:396215 49/183 (27%)
SH3_2 317..394 CDD:400139
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.