DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Patsas

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster


Alignment Length:331 Identity:77/331 - (23%)
Similarity:116/331 - (35%) Gaps:131/331 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KWIP--------------------VLFITAVIAWSYYAYVVEL------CIRNSENRIGMIFMLL 59
            :|||                    .||:.:|:.|.|..|::..      .:|.|           
  Fly   345 RWIPSVSESWGWLFGGAGDSKGPLFLFLFSVLLWGYPMYMIRAIPITWNILRRS----------- 398

  Fly    60 FYHLFLTLFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRAD------SPDTQKRILNNFARDLP 118
             ::.|:      ||..:|..      .|.|.:       |.|      |.|...|.:    :.:|
  Fly   399 -HYCFI------YWNAVMWI------SWAIAN-------RRDPGYIPLSSDAYYRAI----KQIP 439

  Fly   119 VTNRTMNGSV---RFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFL-- 178
            ..::....:|   |.|..|:.::|.||.||.||:.||...|||||::.|||...|..:|.||:  
  Fly   440 YFDKLKKRNVMLTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLS 504

  Fly   179 --------GYALVYCLYV-AFTSLHDFVEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAI 234
                    .|...||:.: .||.|:                 ..|.:.|          :.|..:
  Fly   505 VAVNCSFTIYFACYCVMIEGFTMLY-----------------VLGLIEA----------VVFCGL 542

  Fly   235 MFAISLVSLFGYHIYLVLVNRTTLESF---RAPIFRVGGPDKNG-----YNLGRYANFCEVF--- 288
            .:.::..|:.  |   ..:|.||.|.|   |.|..|    ||.|     ::.|...|..|.|   
  Fly   543 GWILTCTSIL--H---ACMNLTTNEMFNYKRYPYLR----DKRGRYQNPFSRGPILNLLEFFVCL 598

  Fly   289 ---GDD 291
               |||
  Fly   599 PDRGDD 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 38/140 (27%)
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 39/143 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467500
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.