DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Dnz1

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster


Alignment Length:301 Identity:76/301 - (25%)
Similarity:124/301 - (41%) Gaps:55/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KTPCGFCMAVFKWIPVLFIT-AVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWSYW 73
            :.|||....|..:..||:.. .||.|        :.:......:.|.|.::.::..:.|...|:.
  Fly     5 RDPCGIACLVVTYGAVLYADYVVIRW--------IILTTMPGSLWMSFHVVLFNTVVFLLAMSHS 61

  Fly    74 RTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIK 138
            :.:.:..|.:|    :|   .:||..:|...|.|   ||     |......:.....|.:|:..:
  Fly    62 KAVFSDPGTVP----LP---ANRLDFSDLHTTNK---NN-----PPPGNGHSSEWTVCTRCETYR 111

  Fly   139 PDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVEF---- 199
            |.|||||.:|..|:.:|||||||:||||...|.|||:.||       :|||..||:.....    
  Fly   112 PPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFL-------IYVALLSLYSIALIVGSW 169

  Fly   200 -WKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLESFRA 263
             |.......|....|       :...|.:.|..::.:|.:.:.::....::.:|.:.|.:|:.: 
  Fly   170 VWPCEECSQNVIETQ-------LRMIHSVILMLVSALFGLFVTAIMVDQLHAILYDETAVEAIQ- 226

  Fly   264 PIFRVGGPDKNGY--NLGRYANFCEVFGDDW-QYWFLPVFS 301
                    .|..|  |..:|....:|||... ..|.||..|
  Fly   227 --------QKGTYRPNRRKYQLLADVFGRGHPALWLLPCTS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 40/134 (30%)
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 41/153 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467498
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.