DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and ZDHHC21

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001341047.1 Gene:ZDHHC21 / 340481 HGNCID:20750 Length:265 Species:Homo sapiens


Alignment Length:312 Identity:78/312 - (25%)
Similarity:121/312 - (38%) Gaps:99/312 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PCGFC---MAVFKWI-PVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWSY 72
            |.|:|   :.||.|: .::.|..::.:.:|          .|..|..|.:::||.:.:...: :.
Human    11 PHGWCCMGLIVFVWLYNIVLIPKIVLFPHY----------EEGHIPGILIIIFYGISIFCLV-AL 64

  Fly    73 WRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKII 137
            .|..:|..||:|:..:||..|  |.|                             ...|.||.::
Human    65 VRASITDPGRLPENPKIPHGE--REF-----------------------------WELCNKCNLM 98

  Fly   138 KPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFV-------LFLGYALV--YCLYVAFTSL 193
            :|.|:||||.|..||.:|||||||:||||...|:..|:       |...|||:  :|.|..|..|
Human    99 RPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPL 163

  Fly   194 HDFVEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLF-----------FIAIMFAISLVSLFGYH 247
                   |....|                    ||:|           |:.|...:.:..||...
Human   164 -------KKRNLD--------------------LFVFRHELAIMRLAAFMGITMLVGITGLFYTQ 201

  Fly   248 IYLVLVNRTTLESFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQ-YWFLP 298
            :..::.:.|::|........:..|.|....     .|.||||..|: .||:|
Human   202 LIGIITDTTSIEKMSNCCEDISRPRKPWQQ-----TFSEVFGTRWKILWFIP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 43/149 (29%)
ZDHHC21NP_001341047.1 DHHC 92..217 CDD:396215 44/151 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157917
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.