DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and CG17075

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster


Alignment Length:529 Identity:114/529 - (21%)
Similarity:171/529 - (32%) Gaps:190/529 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MAVFKWIPVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWSYWRTIMTSVG 81
            :.:|.|: ||.:..|.  ||:..:.....|......|:|..|...|:.      |:...::|...
  Fly   113 LQIFGWL-VLLLFGVA--SYWVLIPAFHARIQGPLYGLITGLYLVHIA------SHLTALLTDPA 168

  Fly    82 RIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKI-IKPDRAHHC 145
                     |:|:.|:.|.|      ||:..|.|. ..::...||.   |..|.| ...:|..||
  Fly   169 ---------DKELRRVHRND------RIVPEFDRS-KHSHVIENGR---CHLCNIRTSSNRTKHC 214

  Fly   146 SVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFT------------------- 191
            |||:.||.|.||||.|:|:|:...||..|::.:..|:|..|.:...                   
  Fly   215 SVCNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYW 279

  Fly   192 ----SLH-----DFV-------------------------EFW---------------------- 200
                |.|     ||:                         |.|                      
  Fly   280 CPTESSHTIESGDFINITLSLSNGTMMLIEQHTSEEDVHQEMWDEEQANMTISTLPTLLENFTAI 344

  Fly   201 ------KVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVS------LFGYHIYLVLV 253
                  :.|....|  ..:.|...:|:|....:|:|.:.::..::.||      |..:|||:..:
  Fly   345 IEASATRPGISPTN--HTETQPVVTGIGLNETIFMFLLGVLGLLAAVSAGLLLHLCFFHIYISFL 407

  Fly   254 NRTTLESFR----------------APIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFLPVFSS 302
            ..||.|..|                ||..|.   .||| |:...|:..|...        |..|.
  Fly   408 GLTTYEYIRNHRQAQDAKTKQLLEGAPGVRA---PKNG-NVHFSASLPEPHN--------PSKSL 460

  Fly   303 RGDGYSYPTSSDQSRVSTSSPTQR-YDAMGDTTTS-RLDGNPTDKLIGASPLDTTNHHHNQSPHQ 365
            .|....|..|      |...|:|. .:::|.|..| ||.            ...::...:||...
  Fly   461 PGGQQLYCCS------SAPHPSQHSQESVGQTEQSLRLH------------CCASSREFHQSGQA 507

  Fly   366 VRSTSVLPTQLLQIQ-PPSTCRDELNERQQKLANGQSLDCSTPAAMSSPDERGVNGAAVYIEMIG 429
            :...|:|...:.||| .|.|.              .|..|.:..|.||...|         ..:.
  Fly   508 IYVCSLLEEAVPQIQVEPDTL--------------SSFHCCSSFAASSLQRR---------VSLA 549

  Fly   430 DHPLTSADP 438
            ...|.||:|
  Fly   550 KGSLISAEP 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 46/217 (21%)
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.