DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001013141.1 Gene:Zdhhc4 / 304291 RGDID:1308389 Length:343 Species:Rattus norvegicus


Alignment Length:334 Identity:88/334 - (26%)
Similarity:126/334 - (37%) Gaps:99/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RKTPCGFCMAVFKWIPVLFIT---AVIA---------WSYYAYVVELCIRNSENRIGMI---FML 58
            |.||..|..||...:..||.|   |.:|         ::.|.|.|....|..|..:..:   ::|
  Rat    43 RVTPQCFQRAVQTLLHQLFHTRHPAFLALHLLLQGLVYAEYTYEVFSYCRELEFSLPCLLLPYVL 107

  Fly    59 LFYHL-FLTLFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRI---LNNFARD--- 116
            |..:| |.||       |..|:.|.|                     |:..:   |..:..|   
  Rat   108 LSVNLVFFTL-------TCSTNPGTI---------------------TKTNVLLLLQVYEFDEVM 144

  Fly   117 LPVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFL--- 178
            .|..:|        |..|.:.||.|:.||.||..||.:.||||.|||||:..:|..||:::|   
  Rat   145 FPKNSR--------CSTCDLRKPARSKHCRVCDRCVHRFDHHCVWVNNCIGAWNTGYFLIYLLTL 201

  Fly   179 --GYALVYCLYVAF-------------TSLHDFVEFWKVGAYDNNGYSAQGQLNASGMGRFHILF 228
              ..|.:..|..||             |.|.|...|..|    :.|:..|....|..    .|:|
  Rat   202 TASAATIAILSAAFLLRLVAVSNLYQETYLDDLGRFQAV----DTGFLIQHLFLAFP----RIIF 258

  Fly   229 LFFIAIMFAISLVSLFGYHIYLVLVNRTTLESFRA--------PIFRVGGPD------KNGYNLG 279
            |....|:.::.|.....:.:||...|:||.|.:|.        |:. ...|.      :|.|:.|
  Rat   259 LLGFVIVLSLLLAGYLCFALYLAATNQTTNEWYRGDWAWCQHWPLV-AWSPSAEPQIHQNIYSHG 322

  Fly   280 RYANFCEVF 288
            .::|..|||
  Rat   323 LWSNLQEVF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 46/147 (31%)
Zdhhc4NP_001013141.1 zf-DHHC 151..292 CDD:279823 47/148 (32%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351923
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.