DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc9

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001034105.2 Gene:Zdhhc9 / 302808 RGDID:1561389 Length:364 Species:Rattus norvegicus


Alignment Length:371 Identity:100/371 - (26%)
Similarity:152/371 - (40%) Gaps:73/371 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWSYWRTIMTSVGRIPDQWRIP 90
            ||:.......::|:............|.:...:||.....||.     ||..:..|.||.  .:|
  Rat    42 LFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLL-----RTSFSDPGVIPR--ALP 99

  Fly    91 DEEVSRLFRADS-----PDTQK---RILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSV 147
            ||........::     |..|:   ||.|     ..:.|:.:  .:::|..|||.:|.||.|||:
  Rat   100 DEAAFIEMEIEATNGAVPQGQRPPPRIKN-----FQINNQIV--KLKYCYTCKIFRPPRASHCSI 157

  Fly   148 CSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYV-AFTSLHDFVEFWKVGAYDNNGYS 211
            |..||.:.|||||||.|||...||:||.||:....:..:|| ||..::..::..|:|..:.    
  Rat   158 CDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLET---- 218

  Fly   212 AQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLESFRAPIF---RVGGPDK 273
                |..:......:|..||.    ..|:|.|.|:|.:||.:|:||.|..:....   ||..|..
  Rat   219 ----LKETPGTVLEVLICFFT----LWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYS 275

  Fly   274 NGYNLGRYANFCEVFGDDWQYWFLP--VFSSRGDGYSYPTSSDQSRVSTSSPTQRYDAMGDTTTS 336
            :| |:.:  |.|||....     ||  |...||   ..|.....||..::..|            
  Rat   276 HG-NIVK--NCCEVLCGP-----LPPSVLDRRG---ILPLEESGSRPPSTQET------------ 317

  Fly   337 RLDGNPTDKLIGASPLDTTNHHHNQSPHQVRSTSVLPTQLLQIQPP 382
                  :..|:..||..|.:.:.|::|..    |..|.::...:||
  Rat   318 ------SSSLLPQSPASTDHMNSNETPED----SSTPEEMPPPEPP 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 49/130 (38%)
Zdhhc9NP_001034105.2 zf-DHHC 138..261 CDD:279823 50/134 (37%)
ANXA2R <284..>343 CDD:292349 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351925
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.