DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc3

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_038937239.1 Gene:Zdhhc3 / 301081 RGDID:1309041 Length:350 Species:Rattus norvegicus


Alignment Length:299 Identity:89/299 - (29%)
Similarity:128/299 - (42%) Gaps:71/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CGFCMAVFKWIPVLFITAVIAWSY------YAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWS 71
            ||...|:..|..||:...|:.:..      |||    .|.|     |::|.||.:     |.:.|
  Rat    43 CGIACAIVTWFLVLYAEFVVLFVMLIPSRDYAY----SIIN-----GIVFNLLAF-----LALAS 93

  Fly    72 YWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRF-CEKCK 135
            :.|.::|..|.:|.                         .|..::...:.:...|.|.: |.||.
  Rat    94 HCRAMLTDPGAVPK-------------------------GNATKEFIESLQLKPGQVVYKCPKCC 133

  Fly   136 IIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLY----VAFTSLHDF 196
            .||||||||||||..|:.|||||||||||||...|.||||||..|..:..|:    |.|..||.|
  Rat   134 SIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCF 198

  Fly   197 VEFW-KVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLES 260
            .|.| |..::            :.......::.|.|.|::|.|....:||..::.:..:.|.:|.
  Rat   199 EEDWTKCSSF------------SPPTTVILLILLCFEALLFLIFTSVMFGTQVHSICTDETGIER 251

  Fly   261 FRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQY-WFLP 298
            .:    |...|.:..   |.:.:..|.||.::.. ||.|
  Rat   252 LQ----RSKQPREQS---GSWKSVQEAFGGEFSLNWFNP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 54/135 (40%)
Zdhhc3XP_038937239.1 DHHC 128..253 CDD:396215 55/136 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.