DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001034422.1 Gene:Zdhhc25 / 300323 RGDID:1598341 Length:279 Species:Rattus norvegicus


Alignment Length:306 Identity:79/306 - (25%)
Similarity:122/306 - (39%) Gaps:75/306 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KTPCGFCMAVFKWIPVLFITAVIAWSY-----YAYVVELCIRNSENRIGMIFMLLFYHLFLTLFM 69
            :||...|..:..  |:..:.|:..|:.     :..|.:|.| .|.|.:.::...:.:||..:|.:
  Rat    22 QTPNQRCWFILD--PIGILCAMATWALVLSGGWVLVRDLLI-PSNNMLYIVANGMIFHLLASLAL 83

  Fly    70 WSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKC 134
            .|:.||::|..|.:|            |.....|||                      |.:|..|
  Rat    84 VSHLRTMLTDPGSVP------------LGNRPGPDT----------------------VSYCPDC 114

  Fly   135 KIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVEF 199
            :...|.||.||:||..|:.|.|||||||||||...|.|||:||:       :|:..:..|..:..
  Rat   115 RSAIPKRAAHCAVCKRCIRKNDHHCPWVNNCVGEDNQKYFLLFI-------MYIGLSGTHVLLLL 172

  Fly   200 -------WKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIM-FAISLVSLFGYHIYLVLVNRT 256
                   :..|.:|:         ::|......||||..:|:| |.:|.|.|. ..:..:..::|
  Rat   173 GIPVLCSYARGEWDS---------SSSVSPPAPILFLLLVALMGFVLSSVMLC-TQMCTIYTDKT 227

  Fly   257 TLESFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQY-WFLPVFS 301
            |.|.........|       |..:.||...:.|..... |..|..|
  Rat   228 TTELLYQNTHSPG-------NRAKCANLKAICGSHISLAWLSPFHS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 45/137 (33%)
Zdhhc25NP_001034422.1 zf-DHHC 109..230 CDD:279823 45/137 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351909
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.