DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc21

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001034098.1 Gene:Zdhhc21 / 298184 RGDID:1305750 Length:265 Species:Rattus norvegicus


Alignment Length:293 Identity:72/293 - (24%)
Similarity:124/293 - (42%) Gaps:61/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PCGFC---MAVFKWI-PVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWSY 72
            |.|:|   :.||.|: .::.|..::.:.:|          .|..|..|.:::||.:.:...: :.
  Rat    11 PHGWCCMGLIVFVWLYNIVIIPKIVLFPHY----------EEGHIPGILIIIFYGISIFCLV-AL 64

  Fly    73 WRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKII 137
            .|..:|..||:|:..:||..|                     |:|          ...|.||.::
  Rat    65 VRASLTDPGRLPENPKIPHAE---------------------REL----------WELCNKCNLM 98

  Fly   138 KPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYA-LVYCLYVAFTSLHDFVEFWK 201
            :|.|:||||.|..||.:|||||||:||||...|:..|:....|. |:.|..:.|:..| :..|..
  Rat    99 RPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCH-YYYFLP 162

  Fly   202 VGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLESFRAPIF 266
            :...:.:.:..:.:|....:..       |:.|...:.:..||...:..::.:.|::|.......
  Rat   163 LKTRNLDLFVVRHELAIMRLAA-------FMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCE 220

  Fly   267 RVGGPDKNGYNLGRYANFCEVFGDDWQ-YWFLP 298
            .:..|.|....     .|.||||..|: .||:|
  Rat   221 EISRPRKPWQQ-----TFSEVFGTRWKILWFIP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 37/130 (28%)
Zdhhc21NP_001034098.1 DHHC 92..217 CDD:396215 38/132 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.