DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and AT2G14255

DIOPT Version :10

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_973453.2 Gene:AT2G14255 / 2745525 AraportID:AT2G14255 Length:536 Species:Arabidopsis thaliana


Alignment Length:306 Identity:82/306 - (26%)
Similarity:125/306 - (40%) Gaps:87/306 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PCGFCMAVFKWIPVLFITAVIAWSYYAYVVEL-----CIRNSENRIGMIFMLLFYHLFLTLFMWS 71
            |..|.:.|.  :.|||||::::.|....:..:     |...|   .|:..::.||          
plant   272 PMLFSLIVI--LMVLFITSIVSASNLPKITAMVGLWACFGLS---CGVYALITFY---------- 321

  Fly    72 YWRTIMTSVGRIPDQWRIPDEE---VSRLFRADSPDTQKRILNNFARDLPVTNRTMNGS-VRFCE 132
                            |:..::   |.|...|:|..|    .|:...|:...|.:..|: .:.|.
plant   322 ----------------RVSRKDPGYVKRTGEANSQHT----ANDPLIDINFKNPSWKGNWSQLCP 366

  Fly   133 KCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFV 197
            .||||:|.|:.||..|..||.:.||||||::|||...|.:||::|          |...:|..||
plant   367 TCKIIRPVRSKHCPTCKRCVEQFDHHCPWISNCVGKKNKRYFLVF----------VIMGALTSFV 421

  Fly   198 EFWKVGAYDNNGYSAQGQLNASGMGRFH----------------ILFLFFIAIMFAISLVSLFGY 246
                      .|.:|..:| ..|:.:.|                .:||||..::| |:.::|...
plant   422 ----------GGTTAVQRL-WRGIPQVHHGESWIKHIVIEHPDAAVFLFFDLLIF-IATMTLTIS 474

  Fly   247 HIYLVLVNRTTLESFRAPIFR-VGGPD---KNGYNLGRYANFCEVF 288
            ..|::..|.||.|.:.|..|. :.|||   .|.||.|...| |..|
plant   475 QSYMIARNITTNELWNAKRFSYLRGPDGRFYNPYNHGLRRN-CTDF 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 DHHC 129..259 CDD:396215 45/145 (31%)
AT2G14255NP_973453.2 ANKYR 26..248 CDD:440430
ANK repeat 57..88 CDD:293786
ANK repeat 92..155 CDD:293786
ANK repeat 157..188 CDD:293786
ANK repeat 190..214 CDD:293786
ANK repeat 225..254 CDD:293786
DHHC 363..492 CDD:396215 46/150 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.