DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_955013.1 Gene:Zdhhc19 / 245308 MGIID:2682948 Length:347 Species:Mus musculus


Alignment Length:340 Identity:73/340 - (21%)
Similarity:122/340 - (35%) Gaps:115/340 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AVFKWIPVLFITAVIAWSYYAYVVELCIRNSENRI----GMIFMLLFYHLFLTLFMWSYWRTIMT 78
            |.|....:||::.:    ::.:.....::|.|...    |.:|:|.|:.|....|          
Mouse    31 AAFNVTLLLFLSGL----FFGFPCRWLVQNGEWAFPAITGPLFILTFFSLVSLNF---------- 81

  Fly    79 SVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVR-----FCEKCKIIK 138
                         .:...|.|..:            ::.|:|...:..:.|     :|.||...:
Mouse    82 -------------SDPGILHRGST------------KEDPMTVHVVRVNQRAFRLEWCPKCLFHR 121

  Fly   139 PDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFV-------LFLGYALVYCLYVAFTSLHDF 196
            |.|.:||..|:.||...||||.|||||:...|::.|:       |:.|..||.||...|.:.|  
Mouse   122 PPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRLFMLLVLSLCLYSGALLVTCLTFLFRTRH-- 184

  Fly   197 VEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISL-------VSLFGYHIYLVLVN 254
            :.|    :.| .|.:....:.|:|.    ::.||.:.::.|:|:       .|...||       
Mouse   185 LPF----SLD-KGMAILVAVPAAGF----LIPLFLLLLIQALSVSRAESSYESKCRYH------- 233

  Fly   255 RTTLESFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFLPVFSSRGDGYSYPTSSDQSRVS 319
                            |:.|.::.|...|           |:|.:|:..|..|.......|..|.
Mouse   234 ----------------PEYNPFDQGFAKN-----------WYLAMFAPLGPNYMSEVVCLQRPVG 271

  Fly   320 TS--------SPTQR 326
            |:        ||.:|
Mouse   272 TAWIQEKTKPSPPRR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 42/148 (28%)
Zdhhc19NP_955013.1 DHHC 109..>181 CDD:366691 27/71 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..347 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.