DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_666185.3 Gene:Zdhhc14 / 224454 MGIID:2653229 Length:489 Species:Mus musculus


Alignment Length:482 Identity:113/482 - (23%)
Similarity:169/482 - (35%) Gaps:121/482 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RRKTPCGFCMAVFKWIPVLFITAVI----AWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLF 68
            |.|..|...:.:.:...|.::|.::    :..::|:............|.::..:||:.:..||.
Mouse    46 RNKFFCNGRIMMARQTGVFYLTLILILVTSGLFFAFDCRYLAEKITPAIPVVGGILFFFVMGTLL 110

  Fly    69 MWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVR---- 129
                 ||..:..|.:|.  ..|||..                 :..|.:.:.|.|.:|..|    
Mouse   111 -----RTSFSDPGVLPR--ATPDEAA-----------------DLERQIDIANGTSSGGYRPPPR 151

  Fly   130 --------------FCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLF-LG 179
                          :|..|||.:|.||.|||:|..||.:.|||||||.|||...||::|.:| |.
Mouse   152 TKEVVINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVEQFDHHCPWVGNCVGKRNYRFFYMFILS 216

  Fly   180 YALVYCLYVAFTSLHDFVEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAI-SLVSL 243
            .:.:.....||...|......:.|..|....|....|.|             :...|:: |::.|
Mouse   217 LSFLTVFIFAFVITHVIHRSQQKGFLDALKDSPASVLEA-------------VICFFSVWSIIGL 268

  Fly   244 FGYHIYLVLVNRTTLESFRAPIFRVGGPDK-NGYNLGR-YANFCEVFGDDWQYWFLPVFSSRGDG 306
            .|:|.||:..|:||.|..:.......|.:. |.|:.|. :.|.|.....       |:..|..|.
Mouse   269 SGFHTYLISSNQTTNEDIKGSWSNKRGKENYNPYSYGNIFTNCCVALCG-------PISPSLIDR 326

  Fly   307 YSYPTSSDQSRVSTSSPTQRYDAMGDTTTSRLDGNPTDKLIGASPLDTTNHHHNQSPHQVRSTSV 371
            ..|.........:.|:....|.|    |.|:.|....|:.|             ||...|...:.
Mouse   327 RGYVQPDTPQPAAPSNGITMYGA----TQSQSDMCDQDQCI-------------QSTKFVLQAAA 374

  Fly   372 LPTQLLQIQPPSTCRD-------ELNERQQKLANGQSL------DCSTPAAMSS----PDERGVN 419
            .|  |||.:|..|..:       .|......|..||..      :.:|.|.:|.    .||.   
Mouse   375 TP--LLQSEPSLTSEELHMPGKPGLGTPCASLTLGQPTPPSSMPNLATEATLSDIMPLKDEH--- 434

  Fly   420 GAAVYIEMIGDHPLTSADPAKGFPRPP 446
                     |.|...:.|.|   |.||
Mouse   435 ---------GGHQFLTPDEA---PSPP 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 47/149 (32%)
Zdhhc14NP_666185.3 zf-DHHC 164..289 CDD:307600 47/137 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..454 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.