DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and dhhc-9

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001362080.1 Gene:dhhc-9 / 183426 WormBaseID:WBGene00016620 Length:313 Species:Caenorhabditis elegans


Alignment Length:199 Identity:56/199 - (28%)
Similarity:86/199 - (43%) Gaps:47/199 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFL---- 178
            ||.|....|. .||.||...|.|.|||||||..|||.|||||.|:|.||..:|:::|.||:    
 Worm   100 PVANPGEEGD-SFCSKCNYWKSDNAHHCSVCEKCVLGMDHHCIWINQCVGLHNHRHFFLFIANLT 163

  Fly   179 --GYALVYCLYVAFTSLHDFVEFWK----------------VGAYDNNGYSAQGQLNASGMGRFH 225
              ...::...|.:|:. |.|:|..:                :..||             |..|..
 Worm   164 LAAATIIIAGYQSFSD-HLFLESSQTTYCTTILEHAPLQDIICDYD-------------GFARTS 214

  Fly   226 ILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLESFRAPIFRVGGPDKN-----GYNLGRYANFC 285
            ::|.:.::.:..:.:..|..::|||:.:..|.::     ..::.|..||     ..|.|..||:.
 Worm   215 VVFCYLLSGILLVMVGGLTSWNIYLISIGCTYID-----YLKLTGSKKNTSARKRLNKGFKANWR 274

  Fly   286 EVFG 289
            ...|
 Worm   275 NFLG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 44/151 (29%)
dhhc-9NP_001362080.1 DHHC 106..251 CDD:366691 45/164 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.