DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and dhhc-10

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_508805.3 Gene:dhhc-10 / 180745 WormBaseID:WBGene00019344 Length:327 Species:Caenorhabditis elegans


Alignment Length:344 Identity:81/344 - (23%)
Similarity:122/344 - (35%) Gaps:95/344 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KWIPVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLF-------LTLFMW-------S 71
            ||...:.:|.|:..:||:.|..:.....:|...:.::.|...|.       |..|::       :
 Worm    19 KWGGTMLVTFVLISTYYSCVHVIAENMYDNPTHIYWLTLVAKLIILEIAVNLACFVYYARYNSVT 83

  Fly    72 YWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTM-------NGSVR 129
            ||.. .:.|..:            |::..|: :.|..:  .:|...|...|.:       :|| :
 Worm    84 YWHR-KSCVADL------------RVYAEDN-EAQPEV--EYACAQPTVERHLSWEPANESGS-K 131

  Fly   130 FCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFL---GYALVYCLYVAFT 191
            ||..|....|.|:|||.:|..|||:.||||.....||...|.:||::||   ...|...:...|.
 Worm   132 FCFTCNKEAPQRSHHCPLCKMCVLRKDHHCFITGACVGLGNQRYFMVFLFWCAIGLTIAMPHLFF 196

  Fly   192 SLHDFVEFWKVGAYDNN---------------GYSAQGQLNASGMGRFHILFLFFIAIMFAISLV 241
            .::..|.:|    |...               ||....|      ..|..||.|..|.:  |:..
 Worm   197 YMNTEVAYW----YPFGFVYYIGPIAVVRWILGYVPFSQ------ACFSTLFSFAGASL--ITAG 249

  Fly   242 SLFGYHIYLVLVNRTTLE----SFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQY-------W 295
            ..||..:|......|..|    :.||...      .:|.|:|.....  |||..|..       |
 Worm   250 GFFGMQVYYTSQGYTMYEWHNLTVRATFL------GDGENMGERLRL--VFGKHWALNFLIPLPW 306

  Fly   296 FLPVFSSRGDGYSYPTSSD 314
            .|||.:        |..||
 Worm   307 NLPVLT--------PAISD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 41/147 (28%)
dhhc-10NP_508805.3 zf-DHHC 129..270 CDD:279823 44/153 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.