DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and dhhc-7

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_492960.1 Gene:dhhc-7 / 173045 WormBaseID:WBGene00007637 Length:302 Species:Caenorhabditis elegans


Alignment Length:279 Identity:79/279 - (28%)
Similarity:116/279 - (41%) Gaps:75/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VFKWIP-----VLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWSYWRTIMT 78
            :|||.|     |..|..:||::.|..::.|.:....:.|..:|....::..|...:.::.|.:::
 Worm     1 MFKWDPCGLVCVCMIYLLIAYADYVILIWLLLPTFGHSIWTVFHGAVFNCLLATTIVAHTRAMLS 65

  Fly    79 SVGRIP----------------DQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGS 127
            ..|.:|                |:....|||.  :||.|.                 .||:....
 Worm    66 DPGTVPISSSKGQNTPNPVFSSDEEDESDEEA--VFRHDH-----------------LNRSSATE 111

  Fly   128 VRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYA--------LVY 184
            ...|.:|..::|.|||||.||..||.|||||||||||||..||.|:|:.|:.|.        ||.
 Worm   112 WTMCTRCDSLRPPRAHHCRVCKRCVRKMDHHCPWVNNCVGEYNQKWFLQFIFYVGASSAYSLLVL 176

  Fly   185 CLYVAFTSLHDFVEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIY 249
            ||...:   ||        ||...|  .:|.|   |...:|...:.  :||.|:. .:|||..:.
 Worm   177 CLCWVW---HD--------AYGMTG--IKGPL---GENLYHAKVIH--SIMLAME-SALFGLFVL 222

  Fly   250 LV--------LVNRTTLES 260
            .|        ..:.|.:||
 Worm   223 AVSCDQLGAIFTDETAIES 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 52/145 (36%)
dhhc-7NP_492960.1 zf-DHHC 115..240 CDD:279823 52/143 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.