DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and Zdhhc7

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_596885.1 Gene:Zdhhc7 / 170906 RGDID:620205 Length:308 Species:Rattus norvegicus


Alignment Length:268 Identity:69/268 - (25%)
Similarity:113/268 - (42%) Gaps:73/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CGFCMAVFKWIPVLFITAVIAW-------SYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMW 70
            ||...||..|:.|::...|:.:       .::..||.          |::|..|     ..|.:.
  Rat    46 CGMVCAVMTWLLVVYADFVVTFVMLLPSKDFWYSVVN----------GVLFNCL-----AVLALS 95

  Fly    71 SYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRF-CEKC 134
            |:.||::|..|.:|.                         .|..::...:.:...|.|.: |.||
  Rat    96 SHLRTMLTDPGAVPK-------------------------GNATKEYMESLQLKPGEVIYKCPKC 135

  Fly   135 KIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFV-- 197
            ..|||:||||||:|..|:.|||||||||||||...|.::||||       .:|:|.:|:|..:  
  Rat   136 CCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLF-------TMYIALSSIHALILC 193

  Fly   198 --EFWKVGAYDNNGYSAQGQLN-----ASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNR 255
              :|..         ..:||..     :..:....::||....::|......:||..|:.:..:.
  Rat   194 GLQFIS---------CVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGTQIHSICNDE 249

  Fly   256 TTLESFRA 263
            |.:|..::
  Rat   250 TEIERLKS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 46/139 (33%)
Zdhhc7NP_596885.1 DHHC 131..258 CDD:396215 47/143 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351917
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.