DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and zdhhc1

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_002937368.1 Gene:zdhhc1 / 100490202 XenbaseID:XB-GENE-989930 Length:562 Species:Xenopus tropicalis


Alignment Length:167 Identity:45/167 - (26%)
Similarity:71/167 - (42%) Gaps:29/167 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 LPVTNRTMNGSV---RFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFL 178
            |||.:...:..|   ..|..|::....::.|||:|:.||...||||.|:||||...||..|...|
 Frog   108 LPVFDHNKHAHVIENMHCYICEVDVGPKSKHCSICNKCVSNFDHHCKWLNNCVGEKNYWLFFNCL 172

  Fly   179 GYALVYCLYVAFTSLHDFVEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFF---------IAI 234
            ..|.:....::..|.:.|||::...|........:...|.|     .:.|:|.         .||
 Frog   173 ISAFLGTFLLSTISTYVFVEYFVDPAMLRTSQQFEAIQNLS-----DVWFVFLPSAPVETKAPAI 232

  Fly   235 MFAISLVSLFG------------YHIYLVLVNRTTLE 259
            :...::||:.|            :|:||:....:|.|
 Frog   233 LALAAIVSVMGLITILLIGQLLCFHVYLLWNKLSTYE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 40/150 (27%)
zdhhc1XP_002937368.1 SBF 35..>78 CDD:388533
DHHC 124..274 CDD:366691 41/151 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.