DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and zdhhc7

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_002936046.1 Gene:zdhhc7 / 100485887 XenbaseID:XB-GENE-944330 Length:304 Species:Xenopus tropicalis


Alignment Length:266 Identity:72/266 - (27%)
Similarity:110/266 - (41%) Gaps:69/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CGFCMAVFKWIPVLFITAVIAWSYYAYVVELCIRNSENRI--GMIFMLLFYHLFLTLFMWSYWRT 75
            ||...||..|:.|.:...|:     .:|:.|..|:....:  |.:|..|     ..|.:.|:.||
 Frog    43 CGMVCAVITWLLVFYADFVV-----TFVMLLPSRDFWYSVINGTLFNCL-----AVLALTSHLRT 97

  Fly    76 IMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRF-CEKCKIIKP 139
            ::|..|.:|.                         .|..::...:.:...|.|.: |.||..|||
 Frog    98 MLTDPGAVPK-------------------------GNATKEYMESLQLKPGEVIYKCPKCCSIKP 137

  Fly   140 DRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFL-------GYALVYCLYVAFTSLHDFV 197
            :||||||:|..|:.|||||||||||||...|.::||||.       .|||:.|....||.:    
 Frog   138 ERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALISTYALILCGLQLFTCV---- 198

  Fly   198 EFWKVGAYDNNGYSAQGQLNASG-----MGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTT 257
                           :||..|..     :....::||....::|......:||..|:.:..:.|.
 Frog   199 ---------------KGQWTACSSFSPPVTVILMIFLCLEGLLFLTFTAVMFGTQIHSICNDETE 248

  Fly   258 LESFRA 263
            :|..::
 Frog   249 IERLKS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 48/142 (34%)
zdhhc7XP_002936046.1 DHHC 128..255 CDD:366691 49/146 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.