DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and slc66a1l

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001123690.1 Gene:slc66a1l / 100170445 XenbaseID:XB-GENE-5794175 Length:303 Species:Xenopus tropicalis


Alignment Length:116 Identity:25/116 - (21%)
Similarity:41/116 - (35%) Gaps:44/116 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 PWV----NNCVNFYNYKYFVLFLGYALVYC--------LYVAFTSLH----------------DF 196
            ||:    ..||. ..::|:.:.:|...:.|        ||||.|:..                ||
 Frog    26 PWIWQLLQQCVE-NAWEYWSVIVGLVSIACFLFAALPQLYVAHTNGRVDQALSLGFLLCWLGGDF 89

  Fly   197 VEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYH 247
            ..|  :|.|..|....|           .|..:|::.:  .|.::|.|.|:
 Frog    90 TNF--IGCYLTNQLPLQ-----------IITAIFYVNM--DIIMISQFSYY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 25/116 (22%)
slc66a1lNP_001123690.1 PQ-loop 44..103 CDD:282099 13/60 (22%)
PQ-loop 185..238 CDD:282099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000300
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X260
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.