DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and zdhhc16

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_031760679.1 Gene:zdhhc16 / 100145301 XenbaseID:XB-GENE-957764 Length:371 Species:Xenopus tropicalis


Alignment Length:328 Identity:89/328 - (27%)
Similarity:145/328 - (44%) Gaps:70/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VFKWIPVLFITAVIA-WSYYAYVVELC----IRNSENRIGMIFMLLFYHLFLTLFMWSYWRTIMT 78
            |.:|..::|:..||. .|....:|.:|    |..:.:...:.:.:::.|..|.:.::.|::.|.|
 Frog    69 VTRWFGIVFVALVIVLTSSIVLIVYICVLPLIIQTYSTPWIYWHVIYGHWNLIMIVFHYYKAITT 133

  Fly    79 SVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAH 143
            ..| .|.|                          ...|:|        ||..|.||...||.|.|
 Frog   134 PPG-YPSQ--------------------------METDIP--------SVSICRKCIAHKPARTH 163

  Fly   144 HCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTS------LHDFVEFWKV 202
            |||:||.|||||||||||:||||..||::||..|..:..:.|:|.:|:|      .:..:|..|:
 Frog   164 HCSICSRCVLKMDHHCPWLNNCVGHYNHRYFFSFCLFMTMGCIYCSFSSRVMFREAYSAIEKMKL 228

  Fly   203 GAYDNNGYSAQGQLNAS-------GMGRFH--ILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTL 258
            ...:...::|....|.:       ....||  |::|:.:....|::|.:|..:|..|:....|::
 Frog   229 QEKERLQFAANETYNDTPPPTFTFRERMFHKCIIYLWVLCSSVALALGALTLWHAMLITRGETSI 293

  Fly   259 ESF-----RAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQ-YWF----LPVFSSR---GDGYSYP 310
            |..     |..:..:|....|.|:.||..|:...||.:.: :|.    ||  ||.   |:|.::.
 Frog   294 ERHINKKERKRLESIGKVFYNPYSYGRSGNWKVFFGVERKLHWVTRVALP--SSHLPFGNGLTWS 356

  Fly   311 TSS 313
            ..|
 Frog   357 APS 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 50/144 (35%)
zdhhc16XP_031760679.1 DHHC 150..299 CDD:396215 51/148 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.