DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1407 and zdhhc22

DIOPT Version :9

Sequence 1:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_001340992.2 Gene:zdhhc22 / 100000886 ZFINID:ZDB-GENE-131127-476 Length:280 Species:Danio rerio


Alignment Length:305 Identity:78/305 - (25%)
Similarity:115/305 - (37%) Gaps:84/305 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LFITAVIAWSYYAYVVELCI----------RNSENRIGMIFMLLFYHLFLTLFMWSYWRTIMTSV 80
            |..|...|:.|.|.||...:          ::|:..|... ||....:||.|...:....|||. 
Zfish    10 LLNTIAPAYFYAATVVTFALHFLLFTPTIFQSSDVTINPA-MLAHISIFLFLMGNALGNYIMTI- 72

  Fly    81 GRIPDQWRIPDEEVSR-LFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHH 144
                   |.|.|..:. :....|||...||..::         .:||               .|.
Zfish    73 -------RNPSESANETVIPVCSPDCPDRIDAHY---------LLNG---------------RHF 106

  Fly   145 CSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLY-----VAFTSLHDFVEFWKVGA 204
            |.||...:||.||||.:..||:...|.:||::|..|....|||     ||:.::...:.|     
Zfish   107 CKVCKKVILKRDHHCFFTGNCIGNRNMRYFIMFSIYTSSSCLYSLVIGVAYLTIEYSISF----- 166

  Fly   205 YDN-----------NGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGY---HIYLVLVNR 255
             :|           .||...|.:  ||:..|.::.|:   |...|.|||: |:   .:.||...:
Zfish   167 -ENPLTFLTLLPLSTGYFFLGLI--SGLQFFLVIMLY---IWLGIGLVSV-GFCCQQLLLVARGQ 224

  Fly   256 TTLESFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQY-WFLPV 299
            |..|..:..:....|..:        ||..:|||..|.. .|:||
Zfish   225 TWCELQKGQLSECRGTWR--------ANLTDVFGSHWVLGLFVPV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 40/148 (27%)
zdhhc22XP_001340992.2 zf-DHHC 105..233 CDD:307600 41/139 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.