DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-R2 and Cnbd2

DIOPT Version :9

Sequence 1:NP_523671.1 Gene:Pka-R2 / 36041 FlyBaseID:FBgn0022382 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_081861.2 Gene:Cnbd2 / 70873 MGIID:1918123 Length:673 Species:Mus musculus


Alignment Length:343 Identity:75/343 - (21%)
Similarity:138/343 - (40%) Gaps:87/343 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SHTDQSTDDQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDG-------ATAVFPKTDE 110
            |.|.:|..:..|.:..:.|.|.|...    |.:.||...|:   |..|       :..:...|.:
Mouse    47 SDTTESKSESGSDSRSEEDKESPASI----KEIKAETPQPK---DRPGVQIKLSWSQKIKSWTAK 104

  Fly   111 QRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYIND 175
            ::.:|.:.|.::::        ||:|. .||           |||..|...|.|...|:|     
Mouse   105 KKRKLYQLVIDIIM--------MNRVC-KMF-----------RQGLRGFREYQIIEPVHK----- 144

  Fly   176 KHIN-TYNHTGLFGELALL---------YNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKR 230
            ||.: ::......|.::.:         :..|||.::..:                  |.::|..
Mouse   145 KHPDFSFWDKKKQGRISFVTEDFAAQEGHFPPRAISITQK------------------KPSWRTH 191

  Fly   231 KMYEELLNSVPMLKALQNY-ERMNLADALVSKSYDNGER--IIKQGDAADGMYFIEEGTVSVRMD 292
            :..::|.|.:..|...::| |.:.|..|.|.:....|.|  |:|:|...:..|||..|||::..|
Mouse   192 QEIQDLCNILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLGTVAITED 256

  Fly   293 QDDAEVEI----SQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAFERLLGPCMDIMK 353
            :|.:...:    :.|.:|..|||:.|::...|:|:|..   :.:..||.|...:.:.....|.::
Mouse   257 EDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVC---MEETEFLVVDREDFVANKLGDEVQ 318

  Fly   354 ----------RNIDDYES 361
                      ||:|.::|
Mouse   319 KETQYRYNFFRNLDIFQS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-R2NP_523671.1 DD_RII_PKA 11..49 CDD:213046
CAP_ED 124..233 CDD:237999 21/118 (18%)
CAP_ED 242..356 CDD:237999 33/130 (25%)
Cnbd2NP_081861.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 13/48 (27%)
Crp 200..>353 CDD:223736 36/140 (26%)
CAP_ED 211..308 CDD:237999 29/99 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.