DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-R2 and prkg2

DIOPT Version :9

Sequence 1:NP_523671.1 Gene:Pka-R2 / 36041 FlyBaseID:FBgn0022382 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_021331649.1 Gene:prkg2 / 100125912 ZFINID:ZDB-GENE-060531-80 Length:769 Species:Danio rerio


Alignment Length:299 Identity:92/299 - (30%)
Similarity:157/299 - (52%) Gaps:17/299 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SRRKSVFA-EAYDPEADDDDDGATAVFPKTDEQRARL--VESVKNVL--------LFRSLEKEQM 133
            :|||...| .:.:|.:...|...   .||...:.||:  .:|||.:|        ..|.||.:|:
Zfish   123 NRRKGAKAGVSAEPSSRTYDSSG---IPKFYFESARVWKEQSVKKLLTDALNKNQYLRRLEVQQV 184

  Fly   134 NQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDKHINTYNHTGLFGELALLYNMPR 198
            ..:::.|:||..|.|:::|:||:.|::.:|:..|...||.::|.:.:......|||||:|||..|
Zfish   185 KDMVECMYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHNKLLTSIAVWTTFGELAILYNCTR 249

  Fly   199 AATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSY 263
            .|:|:|.::...||:||:.|..|:..:|..:.:.|...|.||.:|.:|...:...:.|.|..:.|
Zfish   250 TASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEVEYY 314

  Fly   264 DNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVE--ISQLGKGQYFGELALVTHRPRAASVYA 326
            :.|:.||::|:..:..|.|..|.:.|.....|.|..  |:.||||.||||.||::...|:|::.|
Zfish   315 NKGDYIIREGEEGNTFYIIANGKIKVTQSTQDHEEPQIINTLGKGDYFGEKALISDDVRSANIIA 379

  Fly   327 TGGVVKLAFLDVKAFERLLGPCMDIMKRNIDDYESQLVK 365
            ....|:...:|.:.|.:.:| ..|.:|:.:..|...|.:
Zfish   380 EEDGVECLVIDRETFSQTVG-TFDELKKYLQSYVDSLAR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-R2NP_523671.1 DD_RII_PKA 11..49 CDD:213046
CAP_ED 124..233 CDD:237999 37/108 (34%)
CAP_ED 242..356 CDD:237999 35/115 (30%)
prkg2XP_021331649.1 CAP_ED 176..284 CDD:237999 37/107 (35%)
CAP_ED 293..408 CDD:237999 35/115 (30%)
STKc_cGK 466..725 CDD:270724
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.