DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TER94 and YTA6

DIOPT Version :9

Sequence 1:NP_001097249.1 Gene:TER94 / 36040 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_015251.1 Gene:YTA6 / 856031 SGDID:S000005995 Length:754 Species:Saccharomyces cerevisiae


Alignment Length:455 Identity:129/455 - (28%)
Similarity:202/455 - (44%) Gaps:86/455 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 NRPNSIDPAL-RRFGRFDREIDIGIPDATGRLEVLRIHTKNMKLHDDVDLE----------QIAA 423
            |||....|.| |:..:..|.|     ....:|:..:.:|..:...::.:||          .:.|
Yeast   354 NRPIIKSPTLNRQNSKSSRNI-----PTNSKLKASKSNTNKVSRRNEQNLEPSSPVLVSATAVPA 413

  Fly   424 ESHGHVGADLASLCSEAALQQIREKMDLIDLED------DKIDAEVLASLAVTMENFRYAMTKSS 482
            ||                 :.:|.|....|.|.      |....::|.|:.....|       :.
Yeast   414 ES-----------------KPMRSKSGTPDKESSASSSLDSRKEDILKSVQGVDRN-------AC 454

  Fly   483 PSALRETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKT 547
            ...|.|.:|......|.||.||.:.|..|:|.|.||...||.| |...:|.||:|.:||||.|||
Yeast   455 EQILNEILVTDEKVYWEDIAGLRNAKNSLKEAVVYPFLRPDLF-KGLREPVRGMLLFGPPGTGKT 518

  Fly   548 LLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNV 612
            ::|||:|.|..:.|.||....||:.:.||||..||.:|..|:..:|.::|.||:||:..||..|.
Yeast   519 MIAKAVATESNSTFFSVSASSLLSKYLGESEKLVRALFYMAKKLSPSIIFIDEIDSMLTARSDNE 583

  Fly   613 GDAGGAADRVINQILTEMDGMGA------------KKNVFIIGATNRPDIIDPAILRPGRLDQLI 665
            .:   ::.|:..::|.:...:.:            ...|.::||||.|..||.|..|  |..:.:
Yeast   584 NE---SSRRIKTELLIQWSSLSSATAQSEDRNNTLDSRVLVLGATNLPWAIDDAARR--RFSRKL 643

  Fly   666 YIPLPDDKSREAILKANLRKSPLA-KEVDLTYIAKVTQGFSGADLTEICQRACKLAIRQAIEAEI 729
            ||||||.::|...||..:.|...: :::|...|.::|:||||:|||.:.:.|....||       
Yeast   644 YIPLPDYETRLYHLKRLMAKQKNSLQDLDYELITEMTEGFSGSDLTSLAKEAAMEPIR------- 701

  Fly   730 RREKERAENQNSAMDMDEDDPVPEITSAHFEEAMKFARRSVSDNDIRKYEMFAQTLQQSRGFGQN 794
                    :....:...:.|.:..|....|:.|:...::|||...::|||      :.|..||.|
Yeast   702 --------DLGDKLMFADFDKIRGIEIKDFQNALLTIKKSVSSESLQKYE------EWSSKFGSN 752

  Fly   795  794
            Yeast   753  752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TER94NP_001097249.1 CDC48 47..787 CDD:273521 125/446 (28%)
CDC48_N 47..129 CDD:280513
CDC48_2 153..213 CDD:215011
AAA 263..392 CDD:278434 8/22 (36%)
AAA 536..669 CDD:278434 50/144 (35%)
Vps4_C <741..783 CDD:286426 10/41 (24%)
YTA6NP_015251.1 SpoVK 201..747 CDD:223540 125/448 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.