DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TER94 and MSP1

DIOPT Version :9

Sequence 1:NP_001097249.1 Gene:TER94 / 36040 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_011542.3 Gene:MSP1 / 852915 SGDID:S000003260 Length:362 Species:Saccharomyces cerevisiae


Alignment Length:354 Identity:113/354 - (31%)
Similarity:173/354 - (48%) Gaps:53/354 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 RFDRE--IDIGIPDATGRLEVLRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIR 446
            :||.:  .|:.:...||    :.::....:|.:||:...::.:|                    |
Yeast     4 KFDLKTITDLSVLVGTG----ISLYYLVSRLLNDVESGPLSGKS--------------------R 44

  Fly   447 EKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKS--SPSALRETVVEVPNTTWTDIGGLESVKK 509
            |......|:.:|:.....|...||::.:...:..|  :|..:        |.|:.|||||:.:..
Yeast    45 ESKAKQSLQWEKLVKRSPALAEVTLDAYERTILSSIVTPDEI--------NITFQDIGGLDPLIS 101

  Fly   510 ELQELVQYPVEHPDKFLKFG-MQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMW 573
            :|.|.|.||:..|:.:.... :|...|||.|||||||||:||||:|.|..|||||::...::..|
Yeast   102 DLHESVIYPLMMPEVYSNSPLLQAPSGVLLYGPPGCGKTMLAKALAKESGANFISIRMSSIMDKW 166

  Fly   574 FGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVIN-----QILTEMDGM 633
            :|||...|..:|..|....||::|.||:||..:.|        .:.|..:.     :.:|..||:
Yeast   167 YGESNKIVDAMFSLANKLQPCIIFIDEIDSFLRER--------SSTDHEVTATLKAEFMTLWDGL 223

  Fly   634 GAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAK-EVDLTYI 697
            .....|.|||||||.:.||.|.||  ||.:...:.||....|..||...|:.:.|.: |.||..|
Yeast   224 LNNGRVMIIGATNRINDIDDAFLR--RLPKRFLVSLPGSDQRYKILSVLLKDTKLDEDEFDLQLI 286

  Fly   698 AKVTQGFSGADLTEICQRACKLAIRQAIE 726
            |..|:||||:||.|:|:.|...|.::.|:
Yeast   287 ADNTKGFSGSDLKELCREAALDAAKEYIK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TER94NP_001097249.1 CDC48 47..787 CDD:273521 113/354 (32%)
CDC48_N 47..129 CDD:280513
CDC48_2 153..213 CDD:215011
AAA 263..392 CDD:278434 3/9 (33%)
AAA 536..669 CDD:278434 56/137 (41%)
Vps4_C <741..783 CDD:286426
MSP1NP_011542.3 MDN1 <10..>164 CDD:227596 53/185 (29%)
RecA-like_ATAD1 92..255 CDD:410928 69/172 (40%)
AAA_lid_3 280..319 CDD:407720 17/36 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.