DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TER94 and Fignl2

DIOPT Version :9

Sequence 1:NP_001097249.1 Gene:TER94 / 36040 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001201840.1 Gene:Fignl2 / 668225 MGIID:3646919 Length:644 Species:Mus musculus


Alignment Length:268 Identity:84/268 - (31%)
Similarity:132/268 - (49%) Gaps:25/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 PNTTWTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQ 558
            |...|.|:.|..::|..|:|.:.:|:..|.......: |.|.|||:||.||||.||.:.:|....
Mouse   382 PPVQWADVAGQGALKAALEEELLWPLLRPPACPGSAL-PPRTVLFFGPRGCGKALLGRCLATRLG 445

  Fly   559 ANFISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVI 623
            |..:.::|..|......|....::..|..||...|.||...|||::..||.      .||:.|. 
Mouse   446 ATLLRLRGAGLAASGAVEGARLLQAAFAAARCRPPAVLLISELDALLPARD------DGASLRA- 503

  Fly   624 NQILTEMDG-MGAKKN-VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKS 686
             .:||.:|| .||:.: |.::|.|:||..:|.|..|  |.....|:.|||..:|..||:..|.:.
Mouse   504 -PLLTCLDGSCGARADGVLVVGTTSRPAALDEATRR--RFALRFYVALPDGAARGQILQRALAQQ 565

  Fly   687 PLA-KEVDLTYIAKVTQGFSGADLTEICQRACKLA---------IRQAIEAEIRREKERAENQ-- 739
            ..| .|.:|..:.:.||||||.:|.::||:|...|         ..:.:||.:.:...||.::  
Mouse   566 GCALNERELAALVQGTQGFSGGELGQLCQQAAAEAGISGLQRPLSYKDVEAALAKVGSRAPSKEL 630

  Fly   740 NSAMDMDE 747
            :|.::.|:
Mouse   631 DSLVEWDK 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TER94NP_001097249.1 CDC48 47..787 CDD:273521 84/268 (31%)
CDC48_N 47..129 CDD:280513
CDC48_2 153..213 CDD:215011
AAA 263..392 CDD:278434
AAA 536..669 CDD:278434 46/134 (34%)
Vps4_C <741..783 CDD:286426 2/7 (29%)
Fignl2NP_001201840.1 SpoVK <381..638 CDD:223540 83/266 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.