DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TER94 and FIGNL1

DIOPT Version :9

Sequence 1:NP_001097249.1 Gene:TER94 / 36040 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001036227.1 Gene:FIGNL1 / 63979 HGNCID:13286 Length:674 Species:Homo sapiens


Alignment Length:361 Identity:120/361 - (33%)
Similarity:179/361 - (49%) Gaps:45/361 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 GKRVRILPIDESTEGVTGNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCI 197
            ||.|..:|..:..|...|    :..|||......|.|            |::.::...:|:...:
Human   338 GKFVPPIPKQDGGEQNGG----MQCKPYGAGPTEPAH------------PVDERLKNLEPKMIEL 386

  Fly   198 VAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVK-PPR 261
            :..|  |...|.|            |.::||.|.....|.|||:|..|:..|.:|  .|:: ||:
Human   387 IMNE--IMDHGPP------------VNWEDIAGVEFAKATIKEIVVWPMLRPDIF--TGLRGPPK 435

  Fly   262 GILMYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFID 326
            |||::||||||||||.:.:|:::||.||.|:...:.||..||.|..:|..|..|....||:||||
Human   436 GILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFID 500

  Fly   327 EIDAIAPKRDKTHGEVERRIVSQLLTLMDGMKKSS--HLIVMAATNRPNSIDPALRRFGRFDREI 389
            |||::..:|.....|..|||.::.|..:||...||  .::|:.|||||..||.|.||  |..:.:
Human   501 EIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARR--RLVKRL 563

  Fly   390 DIGIPDATGRLE-VLRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIR--EKMDL 451
            .|.:|:|:.|.: |:.:.:|......:.::|||..:|....|||:..||.||:|..||  :..|:
Human   564 YIPLPEASARKQIVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQLCREASLGPIRSLQTADI 628

  Fly   452 IDLEDDKIDAEVLASLAVTMEN-FRYAMTKSSPSAL 486
            ..:..|    :|.....:..|| ||......||..|
Human   629 ATITPD----QVRPIAYIDFENAFRTVRPSVSPKDL 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TER94NP_001097249.1 CDC48 47..787 CDD:273521 120/361 (33%)
CDC48_N 47..129 CDD:280513
CDC48_2 153..213 CDD:215011 11/59 (19%)
AAA 263..392 CDD:278434 57/130 (44%)
AAA 536..669 CDD:278434
Vps4_C <741..783 CDD:286426
FIGNL1NP_001036227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..179
Necessary and sufficient for interaction with RAD51. /evidence=ECO:0000305|PubMed:23754376 295..344 3/5 (60%)
SpoVK <374..668 CDD:223540 108/309 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.