DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TER94 and comt

DIOPT Version :9

Sequence 1:NP_001097249.1 Gene:TER94 / 36040 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster


Alignment Length:638 Identity:177/638 - (27%)
Similarity:287/638 - (44%) Gaps:143/638 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETVIFCDGDPIKREEEEESLNAVG-- 224
            |||..|..:|:.  ...|||.:.|..:|.:          ||:..:      :.|..|||..|  
  Fly   153 LEAIDPKSLGEG--KDTAMRNVRFGRILGN----------TVVQFE------KAENSSLNLQGKS 199

  Fly   225 -------------YD----DIGGCRKQLAQI-KEMVELPLRHPSLFKAIGVKPPRGILMYGPPGT 271
                         :|    .|||..|:...| :......:..|.|.:.:|.|..:|||:||||||
  Fly   200 KGKVVRQSIINPDWDFGKMGIGGLDKEFNSIFRRAFASRVFPPELVEQLGCKHVKGILLYGPPGT 264

  Fly   272 GKTLIARAV-----ANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPA--------II 323
            ||||:||.:     |.|..    ::|||:|:.|..||||:|:|:.|.|||:....        ||
  Fly   265 GKTLMARQIGTMLNAREPK----IVNGPQILDKYVGESEANVRRLFAEAEEEEKRLGPNSGLHII 325

  Fly   324 FIDEIDAIAPKRDKTHGE--VERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFD 386
            ..||||||..:|....|.  |...:|:||||.:||:.:.::::|:..|||.:.||.||.|.||.:
  Fly   326 IFDEIDAICKQRGSVAGNSGVHDTVVNQLLTKIDGVDQLNNILVIGMTNRRDMIDEALLRPGRLE 390

  Fly   387 REIDIGIPDATGRLEVLRIHTKNM----KLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIRE 447
            .:::|.:|:..||:::|.||||.|    |::||||.::|||.:....||:|..|...|.    ..
  Fly   391 VQMEISLPNEQGRVQILNIHTKRMREFNKINDDVDNKEIAALTKNFSGAELEGLVRAAQ----SS 451

  Fly   448 KMDLIDLEDDK--IDAEVLASLAVTMENFRYAMTKSSPSALRETVVEVPNTTWTDIGGLESVKKE 510
            .|:.:...|.|  :|.|.:..|.|..::|.:::......|               .|..:.:...
  Fly   452 AMNRLIKADAKVTVDPEAMEKLKVNRDDFLHSLEHDIKPA---------------FGTAQEILDN 501

  Fly   511 L--QELVQY--PVEHPDKFLKFGM---QPSR--------GVLFYGPPGCGKTLLAKAIANECQAN 560
            :  :.::.:  ||.:   .|:.||   |.::        .||..|.|..|||.||..:|......
  Fly   502 MLARGVINWGAPVSN---LLEDGMLYVQQAKAPESSGLVSVLVAGAPNSGKTALAAQLAKMSDFP 563

  Fly   561 FISVKGPELLTMWFGESEA----NVRDIFDKA-RSAAPCVLFFDELDSIAKARGGNVGDAGGAAD 620
            |:.|..||.:.   |.:|:    ::|.|||.| ||...|::    :|::.:     :.|.|....
  Fly   564 FVKVCSPEDMV---GYTESAKCLHIRKIFDDAYRSMLSCIV----VDNVER-----LLDYGSIGP 616

  Fly   621 RVINQ-------ILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAI 678
            |..|.       :|.:....|.|  :.|:..::|.::::...:... ...::::|   :.|:...
  Fly   617 RYSNMTLQALLVLLKKQPPKGRK--LLILCTSSRREVLEEMEMLTA-FTSVLHVP---NLSKPDH 675

  Fly   679 LKANLRKSPLAKEVDLTYIAKVTQG---FSG----------ADLTEICQRACK 718
            :.|.|..:.:..:.::..|.|...|   |.|          |..||..|||.|
  Fly   676 VLAVLENTDIFSKGEIQAIGKKMAGKRVFIGIKKLLGLIDMARQTEQSQRAIK 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TER94NP_001097249.1 CDC48 47..787 CDD:273521 177/638 (28%)
CDC48_N 47..129 CDD:280513
CDC48_2 153..213 CDD:215011 12/50 (24%)
AAA 263..392 CDD:278434 60/143 (42%)
AAA 536..669 CDD:278434 34/144 (24%)
Vps4_C <741..783 CDD:286426
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011 3/4 (75%)
SpoVK 242..699 CDD:223540 144/500 (29%)
AAA 256..397 CDD:278434 61/144 (42%)
AAA 539..668 CDD:278434 34/143 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.