DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TER94 and atad1a

DIOPT Version :9

Sequence 1:NP_001097249.1 Gene:TER94 / 36040 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001004640.1 Gene:atad1a / 368672 ZFINID:ZDB-GENE-030616-593 Length:380 Species:Danio rerio


Alignment Length:290 Identity:93/290 - (32%)
Similarity:152/290 - (52%) Gaps:23/290 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 TWTDIGGLESVKKELQELVQYPVEHPDKFLKFG---MQPSRGVLFYGPPGCGKTLLAKAIANECQ 558
            ||.|:.||:.:..|:|:.|..|.:  .:.|..|   :||.:|||.||||||||||:|||.|....
Zfish    92 TWRDVAGLDEIISEMQDTVILPFQ--KRHLFSGSKLLQPPKGVLLYGPPGCGKTLIAKATAKASG 154

  Fly   559 ANFISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVI 623
            ..||:::...|...|:|||:.....:|..|....||::|.||:||..:.|.....:|......  
Zfish   155 CRFINLQASTLTDKWYGESQKLTAAVFSLAVKIQPCIIFLDEIDSFLRNRSSMDHEATAMMKA-- 217

  Fly   624 NQILTEMDGM--GAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKS 686
             |.::..||:  |....|.::||||||..:|.||||  |:....::.||:...||.||:..|...
Zfish   218 -QFMSLWDGLDTGENSQVMVMGATNRPQDVDAAILR--RMPTAFHVGLPNAAQREEILRLILSGE 279

  Fly   687 PLAKEVDLTYIAKVTQGFSGADLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDEDD-- 749
            .|:..::|..||..::|:||:||.|:|:.|....:|.    .:|:::.:...|...:|.:|:.  
Zfish   280 NLSNAINLKEIASQSEGYSGSDLKELCRDAAMYRVRD----YVRKQQMKQIAQQFQLDEEEEHVD 340

  Fly   750 -----PVPEITSAHFEEAMKFARRSVSDND 774
                 ||.::......:.|:.::::.:..|
Zfish   341 SRQLRPVTQLDLLFGLDKMRESKQATATTD 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TER94NP_001097249.1 CDC48 47..787 CDD:273521 93/290 (32%)
CDC48_N 47..129 CDD:280513
CDC48_2 153..213 CDD:215011
AAA 263..392 CDD:278434
AAA 536..669 CDD:278434 51/134 (38%)
Vps4_C <741..783 CDD:286426 6/41 (15%)
atad1aNP_001004640.1 AAA 128..254 CDD:214640 52/130 (40%)
AAA 132..262 CDD:278434 51/134 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.