DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TER94 and CG4701

DIOPT Version :9

Sequence 1:NP_001097249.1 Gene:TER94 / 36040 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_609721.1 Gene:CG4701 / 34858 FlyBaseID:FBgn0028868 Length:384 Species:Drosophila melanogaster


Alignment Length:323 Identity:104/323 - (32%)
Similarity:170/323 - (52%) Gaps:36/323 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 VLASLAVTMENFRYAMTKSSPSALRETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLK 527
            ::||..||.|:.                    :.:|:||.||:...:||:|.|..||.|...|.:
  Fly    79 MIASHLVTPEDI--------------------DISWSDIAGLDGTIQELRETVVLPVRHRKLFSR 123

  Fly   528 FGM-QPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKARSA 591
            ..: :..:|||.:|||||||||:|||||.:....||::....|...|:|||:.....:|..|:..
  Fly   124 SKLWRAPKGVLLHGPPGCGKTLIAKAIAKDAGMRFINLDVGVLTDKWYGESQKLATAVFTLAKKL 188

  Fly   592 APCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKN--VFIIGATNRPDIIDPA 654
            .||::|.||::|..:.||.|..:   |...:..|.:.:.||:.:..|  |.::||||||..:|.|
  Fly   189 QPCIIFIDEIESFLRMRGSNDHE---ATAMIKTQFMLQWDGLMSNTNICVLVLGATNRPQDLDKA 250

  Fly   655 ILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYIAKVTQGFSGADLTEICQRACKL 719
            |||  |:....:|.:|.|..|..||:..|:...|:..|:|..:|::|.||||:||.|:|:.|...
  Fly   251 ILR--RMPAQFHIGVPRDCQRREILQLILQTEQLSPSVNLKELARLTIGFSGSDLRELCRHASMY 313

  Fly   720 AIRQAIEAEIRREKERAENQNSAMDMD---EDDPVPEITSAHFEEAMKFARRSVSDNDIRKYE 779
            .:||.:..::...:|..:::   ::.|   :|..:.|  ..|.|..|:...:|:|.....|::
  Fly   314 RMRQFMREKLNTGEEIGKDK---IEWDFEVKDQALQE--WEHLEIQMEDLLKSLSVMKASKHQ 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TER94NP_001097249.1 CDC48 47..787 CDD:273521 104/323 (32%)
CDC48_N 47..129 CDD:280513
CDC48_2 153..213 CDD:215011
AAA 263..392 CDD:278434
AAA 536..669 CDD:278434 53/134 (40%)
Vps4_C <741..783 CDD:286426 9/42 (21%)
CG4701NP_609721.1 Parvo_NS1 47..>152 CDD:305166 34/92 (37%)
AAA 130..265 CDD:214640 54/139 (39%)
AAA 133..265 CDD:278434 53/136 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.