DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TER94 and Atad1

DIOPT Version :9

Sequence 1:NP_001097249.1 Gene:TER94 / 36040 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001030174.1 Gene:Atad1 / 309532 RGDID:1308570 Length:361 Species:Rattus norvegicus


Alignment Length:328 Identity:108/328 - (32%)
Similarity:164/328 - (50%) Gaps:25/328 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 IREKMDLID-LEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRETVVEVPN--TTWTDIGGLES 506
            |:..:|.|| ....|::|:..|...:.....:.........::...:|:..|  .||:||.||:.
  Rat    34 IKWMVDAIDPTRKQKVEAQKQAEKLMKQIGVKNVKLSEYEMSIAAHLVDPLNMHVTWSDIAGLDD 98

  Fly   507 VKKELQELVQYPVEHPDKFLKFG-MQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELL 570
            |..:|::.|..|::....|.... :||.:|||.||||||||||:|||.|.|....||:::...|.
  Rat    99 VITDLKDTVILPIKKKHLFENSRLLQPPKGVLLYGPPGCGKTLIAKATAKEAGCRFINLQPSTLT 163

  Fly   571 TMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGA 635
            ..|:|||:.....:|..|....|.::|.||:||..:.|..:..:|......   |.::..||:..
  Rat   164 DKWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSFLRNRSSSDHEATAMMKA---QFMSLWDGLDT 225

  Fly   636 KKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYIA 698
            ..:  |.::||||||..:|.||:|  |:....:|..|..|.||||||..|:...:.:.|||..:|
  Rat   226 DHSCQVIVMGATNRPQDLDSAIMR--RMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVA 288

  Fly   699 KVTQGFSGADLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDEDD--PVPEITSAHFEE 761
            :.|.||||:||.|:|:.|..|.:|:.:            |..|....|||:  ||.:.......|
  Rat   289 QETDGFSGSDLKEMCRDAALLCVREYV------------NSTSEESHDEDEIRPVQQQDLHRAIE 341

  Fly   762 AMK 764
            .||
  Rat   342 KMK 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TER94NP_001097249.1 CDC48 47..787 CDD:273521 108/328 (33%)
CDC48_N 47..129 CDD:280513
CDC48_2 153..213 CDD:215011
AAA 263..392 CDD:278434
AAA 536..669 CDD:278434 50/134 (37%)
Vps4_C <741..783 CDD:286426 9/26 (35%)
Atad1NP_001030174.1 RecA-like_ATAD1 92..257 CDD:410928 61/169 (36%)
AAA_lid_3 282..321 CDD:407720 18/50 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.