DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and HB16

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_195716.1 Gene:HB16 / 830169 AraportID:AT4G40060 Length:294 Species:Arabidopsis thaliana


Alignment Length:51 Identity:21/51 - (41%)
Similarity:31/51 - (60%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRI 130
            ||:..|||.|..||.:...|:.:||.:|.|....:.|||||||.:.|.:::
plant    66 DQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQL 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 20/46 (43%)
HB16NP_195716.1 Homeodomain 59..112 CDD:459649 20/45 (44%)
HALZ 114..155 CDD:460477 0/3 (0%)

Return to query results.
Submit another query.