DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and HB-12

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_191748.1 Gene:HB-12 / 825362 AraportID:AT3G61890 Length:235 Species:Arabidopsis thaliana


Alignment Length:54 Identity:15/54 - (27%)
Similarity:31/54 - (57%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 FTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRI 130
            |:.:|:..||..|..|..:...::.::|.:|.|....:.:||||:|.:.|.:::
plant    34 FSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQL 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 14/49 (29%)
HB-12NP_191748.1 Homeodomain 33..83 CDD:459649 14/48 (29%)
HALZ 85..126 CDD:460477 0/3 (0%)

Return to query results.
Submit another query.