DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and HB6

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_565536.1 Gene:HB6 / 816775 AraportID:AT2G22430 Length:311 Species:Arabidopsis thaliana


Alignment Length:51 Identity:20/51 - (39%)
Similarity:31/51 - (60%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRI 130
            :|:..|||.|..||.:...|:.:||.:|.|....:.|||||||.:.|.:::
plant    69 NQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQL 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 19/46 (41%)
HB6NP_565536.1 Homeodomain 62..115 CDD:459649 19/45 (42%)
HALZ 117..158 CDD:460477 0/3 (0%)

Return to query results.
Submit another query.