DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and NANOG

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_079141.2 Gene:NANOG / 79923 HGNCID:20857 Length:305 Species:Homo sapiens


Alignment Length:129 Identity:40/129 - (31%)
Similarity:58/129 - (44%) Gaps:28/129 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TPPPSPNECL--SSPDNSLNGSRGSEIPADPSV-----------RRYRTAFTRDQLGRLEKEFYK 91
            :|.||..:.|  .|||:|.:........|:.||           ::.||.|:..||..|...|.:
Human    52 SPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQR 116

  Fly    92 ENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRIAVAWP--------------YAAVYS 141
            :.|:|..:..||:..|||....:|.||||:|||.||.: ...||              |.::||
Human   117 QKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQ-KNNWPKNSNGVTQKASAPTYPSLYS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 22/55 (40%)
NANOGNP_079141.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 11/43 (26%)
COG5576 74..191 CDD:227863 32/107 (30%)
Homeodomain 97..152 CDD:459649 22/54 (41%)
Required for DNA-binding. /evidence=ECO:0000269|PubMed:25825768 122..151 13/28 (46%)
8 X repeats starting with a Trp in each unit 196..240
Sufficient for transactivation activity. /evidence=ECO:0000250 196..240
Sufficient for strong transactivation activity. /evidence=ECO:0000250 241..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.