DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and Nanog

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_082292.1 Gene:Nanog / 71950 MGIID:1919200 Length:305 Species:Mus musculus


Alignment Length:113 Identity:42/113 - (37%)
Similarity:59/113 - (52%) Gaps:13/113 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ASPVDQKPLVVDLLATQYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPADPSVRR---YRTAFTR 79
            |||   :|...||  ...|.|.: ..||.:.||||:    ..:|.|...:..:.|   .||.|::
Mouse    51 ASP---RPSSEDL--PLQGSPDS-STSPKQKLSSPE----ADKGPEEEENKVLARKQKMRTVFSQ 105

  Fly    80 DQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKR 127
            .||..|:..|.|:.|:|..:..||::.|||....:|.||||:|||.||
Mouse   106 AQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 24/58 (41%)
NanogNP_082292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..95 16/53 (30%)
Sufficient for interaction with SALL4. /evidence=ECO:0000269|PubMed:16840789 96..155 25/58 (43%)
Homeodomain 98..153 CDD:459649 23/54 (43%)
Required for DNA-binding. /evidence=ECO:0000250|UniProtKB:Q9H9S0 123..152 13/28 (46%)
PTZ00395 <190..>250 CDD:185594
10 X repeats starting with a Trp in each unit 198..247
Sufficient for transactivation activity 198..247
Sufficient for strong transactivation activity 248..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.