DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and hoxb10a

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_571616.1 Gene:hoxb10a / 58056 ZFINID:ZDB-GENE-000328-2 Length:279 Species:Danio rerio


Alignment Length:115 Identity:34/115 - (29%)
Similarity:57/115 - (49%) Gaps:14/115 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KPLVVDLLATQYGKPQTPP-----------PSPNECLSSPDNSLNGSRGSEIPADPSVRRYRTAF 77
            :.::..|..:|..|....|           .:|.|  .:.|.:|..:....:.|... |:.|..:
Zfish   152 RSIITTLSISQRSKDDIEPNNLQTDFTRGDKTPRE--KTQDVTLENAANGWLSAKAG-RKKRCPY 213

  Fly    78 TRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKR 127
            ::.|:..|||||....|::|.||.|::..:||.:..:|:||||||||.|:
Zfish   214 SKHQILELEKEFLFNMYLTRERRLEISRSINLTDRQVKIWFQNRRMKLKK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 24/55 (44%)
hoxb10aNP_571616.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..112
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..187 3/21 (14%)
Homeodomain 207..263 CDD:459649 24/55 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.