DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and hoxb6b

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_571613.1 Gene:hoxb6b / 58053 ZFINID:ZDB-GENE-000823-7 Length:224 Species:Danio rerio


Alignment Length:79 Identity:38/79 - (48%)
Similarity:48/79 - (60%) Gaps:6/79 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NSLNGSRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWF 118
            ||.||..||      :.||.|..:||.|...|||||:...|::|.||.|::..|.|.|..||:||
Zfish   137 NSCNGMPGS------TGRRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWF 195

  Fly   119 QNRRMKDKRQRIAV 132
            ||||||.|::..||
Zfish   196 QNRRMKWKKENKAV 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 29/55 (53%)
hoxb6bNP_571613.1 Antp-type hexapeptide 129..134
Homeodomain 148..204 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.