DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and hoxc1a

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_571606.1 Gene:hoxc1a / 58046 ZFINID:ZDB-GENE-000822-2 Length:302 Species:Danio rerio


Alignment Length:75 Identity:35/75 - (46%)
Similarity:45/75 - (60%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DNSLNGSRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVW 117
            |..|..:.|.:...|.|....||.||..||..|||||:...|::|.||.|:|..|.|.|:.:|:|
Zfish   198 DRELKTNHGRDSDEDTSSGGSRTNFTTKQLTELEKEFHFNKYLTRARRIEIANPLQLSETQVKIW 262

  Fly   118 FQNRRMKDKR 127
            |||||||.|:
Zfish   263 FQNRRMKQKK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 29/55 (53%)
hoxc1aNP_571606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..224 8/25 (32%)
Homeodomain 218..272 CDD:459649 29/53 (55%)

Return to query results.
Submit another query.