DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and Lbx2

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001102714.1 Gene:Lbx2 / 500224 RGDID:1561172 Length:196 Species:Rattus norvegicus


Alignment Length:164 Identity:48/164 - (29%)
Similarity:67/164 - (40%) Gaps:34/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DASPVDQKPL-VVDLLAT---QYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPADPSV-----RR 72
            :|.|....|| .::.||:   |...|:.|.||            .|....|.|..|..     |:
  Rat    33 EAGPDPASPLCALEELASKTFQGHSPRAPQPS------------EGRAVPEAPPGPGTGVRRRRK 85

  Fly    73 YRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRIAVAWPYA 137
            .|||||..|:..||:.|..:.|::...|..|||:|.|..:.:..||||||.|.||          
  Rat    86 SRTAFTPQQVLELERRFVFQKYLAPSERDGLAARLGLANAQVVTWFQNRRAKLKR---------- 140

  Fly   138 AVYSDPAFAASILQAAANSVGMPYPPYAPAAAAA 171
               ......|.:......|.|:..||..|.:|::
  Rat   141 ---DVEEMRADLASLCGLSPGVLCPPALPDSASS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 24/55 (44%)
Lbx2NP_001102714.1 Homeodomain 84..140 CDD:459649 24/55 (44%)

Return to query results.
Submit another query.