DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and Poxm

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster


Alignment Length:163 Identity:44/163 - (26%)
Similarity:56/163 - (34%) Gaps:55/163 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 PY--AAVYS--DPAFAASILQAAANSVGMPYPPYAPAAAAAAAA-----------------AAAV 178
            ||  ||.||  .|..:.|..|.|.....:|:|....:.||||||                 |.|:
  Fly   226 PYSAAAAYSMKTPCGSPSPPQGAGGQGSVPHPHQLRSVAAAAAAAHWPSSHSVSDILAHHQAVAL 290

  Fly   179 ATNPMMATGMPPMG--------MPQMPT--------MQMPGHSGHAGHPSPYGQYRYTPYHIPAR 227
            ..:..:..|:..||        :|..|:        ..:....|.||..|||..|.|.       
  Fly   291 RASCQVGVGVGGMGGMGSTVSPLPMTPSPVAGTAGGQPLLDCEGGAGQQSPYNYYMYF------- 348

  Fly   228 PAPPHPAGPHMHHPHMMGSSATGSSYSAGAAGL 260
                ...|.|.||.|       |...:|||.||
  Fly   349 ----QNGGMHHHHHH-------GGMMAAGATGL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475
PoxmNP_001036687.1 PAX 10..133 CDD:128645
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.