DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and mnx2a

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001009886.2 Gene:mnx2a / 406205 ZFINID:ZDB-GENE-040415-1 Length:309 Species:Danio rerio


Alignment Length:106 Identity:43/106 - (40%)
Similarity:53/106 - (50%) Gaps:24/106 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LVVDLLATQYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPADPSVRRYRTAFTRDQLGRLEKEFY 90
            |::..||...|.||                 :|..|       ..||.|||||..||..||.:|.
Zfish   130 LIMPRLADYSGAPQ-----------------SGLIG-------KCRRPRTAFTSQQLLELENQFK 170

  Fly    91 KENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRIA 131
            ...|:|||:|.|:|..|.|.|:.:|:||||||||.||.|.|
Zfish   171 LNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSRKA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 31/55 (56%)
mnx2aNP_001009886.2 Homeodomain 151..207 CDD:459649 31/55 (56%)

Return to query results.
Submit another query.