powered by:
Protein Alignment eve and exex
DIOPT Version :9
Sequence 1: | NP_523670.2 |
Gene: | eve / 36039 |
FlyBaseID: | FBgn0000606 |
Length: | 376 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648164.1 |
Gene: | exex / 38884 |
FlyBaseID: | FBgn0041156 |
Length: | 525 |
Species: | Drosophila melanogaster |
Alignment Length: | 75 |
Identity: | 38/75 - (50%) |
Similarity: | 49/75 - (65%) |
Gaps: | 6/75 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 63 EIPADP------SVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNR 121
|:.|.| ..||.|||||..||..|||:|.:..|:|||:|.|:|:.|.|.|:.:|:|||||
Fly 426 ELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNR 490
Fly 122 RMKDKRQRIA 131
|||.||.:.|
Fly 491 RMKWKRSKKA 500
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D858478at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.920 |
|
Return to query results.
Submit another query.