DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and lms

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster


Alignment Length:354 Identity:82/354 - (23%)
Similarity:131/354 - (37%) Gaps:93/354 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GKPQTPPPSPNECLSSPDNSLNGSRGSEIPADPS-------VRRYRTAFTRDQLGRLEKEFYKEN 93
            |..:...|:.:.||.  ||..:|....::.:|..       .:|.||||:..|:..||.||.:..
  Fly    47 GASRASSPATSSCLD--DNMDDGKSDIDLASDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGK 109

  Fly    94 YVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQ--------------RIAVA----------- 133
            |:|..:|..||.||.|.|:.||:||||||.|.||:              ::.:.           
  Fly   110 YLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSDVETLASHYYAQLGIGGLARPMVVGDR 174

  Fly   134 -W----------PYAAVYSDPAFAASILQAAANSVGMPYPPYAPAAAAAAAAAAAV---ATNPMM 184
             |          |..::..:.:.:|:.:.:|..:.|.|..|||.:.........:|   |.|.::
  Fly   175 LWLFSQTPTGPTPIQSIMLNGSGSAAPMASATTATGSPMRPYATSGGMPPLPGPSVMESARNAIL 239

  Fly   185 ATGMP-----PMGMPQMPTMQMPGHSGHAGHPSPYGQYRYTPYHIPARPAPPHPAGPHMHHPHMM 244
            |.|.|     |.|:.:.|...:|..| :.....||.    |.|...|...|.:.:...|.:..:.
  Fly   240 ARGQPLNFALPFGVAKPPAGGVPAAS-YIPRCKPYA----TSYVDYAASLPTNESYLQMKYATLP 299

  Fly   245 GSSATGSS--------------------YSAGAAGLLGALPSATCYTGLGVGVPKTQTPPLDLQS 289
            ..:.:|:|                    .|...||      :||.|...|:.         ..|.
  Fly   300 PEAESGASNGLAELERVFGDANANFLQQRSTPVAG------TATAYGHDGLN---------QAQR 349

  Fly   290 SSSPHSSTLSLSPVGSDHAKVFDRSPVAQ 318
            |..|..|....|.:..:|....:..|.|:
  Fly   350 SRRPTQSESECSDIDCEHLDEDEEPPAAE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475 27/51 (53%)
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 17/60 (28%)
Homeobox 89..142 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.