DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and ap

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster


Alignment Length:144 Identity:38/144 - (26%)
Similarity:64/144 - (44%) Gaps:25/144 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YNMESHHAHHDASPVDQKPL--------------VVDLL---ATQYGKPQTPPPSPNECLSSPDN 54
            |:.:....|:|:|.....|.              |::.|   |.|.|:|:...|...|..:: :.
  Fly   283 YSAQFGSPHNDSSSPHSDPSRSIVPTGIFVPASHVINGLPQPARQKGRPRKRKPKDIEAFTA-NI 346

  Fly    55 SLNG-----SRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRC-ELAAQLNLPEST 113
            .||.     .|||.:.:....:|.||:|...|| |..|.::..|:....:.. :|:.:..||:..
  Fly   347 DLNTEYVDFGRGSHLSSSSRTKRMRTSFKHHQL-RTMKSYFAINHNPDAKDLKQLSQKTGLPKRV 410

  Fly   114 IKVWFQNRRMKDKR 127
            ::|||||.|.|.:|
  Fly   411 LQVWFQNARAKWRR 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 19/56 (34%)
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755
LIM2_Lhx2_Lhx9 206..264 CDD:188763
Homeodomain 368..424 CDD:459649 19/56 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.