DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and EVX2

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001073927.1 Gene:EVX2 / 344191 HGNCID:3507 Length:476 Species:Homo sapiens


Alignment Length:233 Identity:105/233 - (45%)
Similarity:135/233 - (57%) Gaps:49/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKD 125
            ||...|| .||||||||||:|:.|||||||:||||||||||||||.|||||:|||||||||||||
Human   180 GSGSGAD-QVRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKD 243

  Fly   126 KRQRIAVAWPYAAVYSDPAFAASILQAAANSVGMPYP----------PY----APAAAAAAAAAA 176
            ||||:|::||:.|   ||:|...::..||.:..:|||          |:    |.||||||:.||
Human   244 KRQRLAMSWPHPA---DPSFYTYMMTHAAATGSLPYPFHSHVPLHYYPHVGVTAAAAAAAASGAA 305

  Fly   177 AVATNPMMATGMPPMGMPQMPTMQMPGHSGHAGHPSPYGQ------YRYTP-YHIPARPAPPHPA 234
            |.|::| .||.:.|     :.|.:...|        ||.:      :|:.. |..||..|..:.|
Human   306 AAASSP-FATSIRP-----LDTFRALSH--------PYSRPELLCSFRHPGLYQAPAAAAGLNSA 356

  Fly   235 GPHMHHPHMMGSSATGSSYSAGAAGLLGALP---SATC 269
            .       ...::|..::.:|.:|...||.|   ||.|
Human   357 A-------SAAAAAAAAAAAASSAAAAGAPPSGGSAPC 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475 45/51 (88%)
EVX2NP_001073927.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..185 2/4 (50%)
Homeobox 192..244 CDD:278475 45/51 (88%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6253
eggNOG 1 0.900 - - E1_KOG0844
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4277
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002730
OrthoInspector 1 1.000 - - otm40654
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46294
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2896
SonicParanoid 1 1.000 - - X2525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1010.040

Return to query results.
Submit another query.