DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and Gsc

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster


Alignment Length:134 Identity:39/134 - (29%)
Similarity:55/134 - (41%) Gaps:42/134 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQT------PPPSPNECLSSPDNSLNGSR 60
            ||        ||.||...    .|....|.|..:|:...      |||...              
  Fly   302 HG--------HHPHHPHG----HPHHPHLGAHHHGQHHLSHLGHGPPPKRK-------------- 340

  Fly    61 GSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKD 125
                      ||:||.||.:||.:||..|.|.:|.....|.:||.:::|.|..::|||:|||.|.
  Fly   341 ----------RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKW 395

  Fly   126 KRQR 129
            ::|:
  Fly   396 RKQK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475 23/51 (45%)
GscNP_001137762.2 Homeobox 343..396 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451029
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.