DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and unc-4

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster


Alignment Length:134 Identity:42/134 - (31%)
Similarity:56/134 - (41%) Gaps:13/134 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LLATQYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENY 94
            ::..:...|...|||..   |:.|....|. |.:..:....||.||.|...||..||:.|...:|
  Fly   207 MIGNRQSLPPAGPPSEG---SNEDGGFPGD-GDDDSSAAKRRRSRTNFNSWQLEELERAFSASHY 267

  Fly    95 VSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRIAVAWPYAAVYSDPAFAASILQAAANSVGM 159
            .....|..||.:|:|.||.:.|||||||.|.:::......|     ..||..|.    .....|.
  Fly   268 PDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTKKGP-----GRPAHNAQ----PQTCSGE 323

  Fly   160 PYPP 163
            |.||
  Fly   324 PIPP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475 24/51 (47%)
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 24/52 (46%)
NK <327..>368 CDD:302627 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450921
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.